TEL: +86 571 56623320    EMAIL: [email protected]

Synthetic Amyloid Beta Peptide 1-42 (Ab1-42)
Synthetic Amyloid Beta Peptide 1-42 (Ab1-42)
Total $114.0
(Vip priceV)
Regular members: $3424.0
  • NO.:SLPA487Hu02
  • Goods click count:477
  • Product Spec:
  • Quantity: - +
  • Limit points for buying:0 Points
  • Manual
  • Add to cart Inquiry Add to favorite
View History [Clear]

Details

Source Peptide synthesis
Predicted Molecular Mass n/a
Buffer Formulation PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
Traits Freeze-dried powder
Purity > 90%
Isoelectric Point n/a
Applications Immunogen; Blocking Peptide.

 

Residues:

DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL

MVGGVVIA

 

USAGE

 

Reconstitute in PBS or others.

 

STORAGE

 

Avoid repeated freeze/thaw cycles. Store at 2-8°C for one month. Aliquot and store at -80°C for 12 months.

 

STABILITY

 

The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.

 

Partial purchase records(bought amounts latest0)

No one bought this product
Total 0 records, divided into1 pages First Prev Next Last

User Comment(Total0User Comment Num)

  • No comment
Total 0 records, divided into1 pages First Prev Next Last
Username: Anonymous user
E-mail:
Rank:
Content:
Verification code: captcha

Call us

+86 571 56623320

Address

Room 1-315, Kongle Changqing Building, No. 160 Guangye Road,Gongshu District, Hangzhou City, Zhejiang Province, China

Join Us with

Leave a message
* To protect against spam, please pass the CAPTCHA test below.
© 2005-2026 SUNLONG BIOTECH CO., LTD Copyright, All Rights Reserved.