TEL: +86 571 56623320 EMAIL: SALES@SUNLONGBIOTECH.COM
Transforming growth factor β2(TGF-β2), a member of the TGF-β superfamily, has a typical cysteine structure. The TGF-β2-deficient mouse had developmental defects in the heart, lungs, craniofacial, limbs, spine, eyes, inner ear, and genitourinal system. All TGF-β subtypes signal through the same receptor heteromeric complex, which consists of a ligand-bound TGF-β type II receptor (TβR-II) and a TGF-β type I receptor (TβR-I). Signal transduction from the receptor to the nucleus is mediated by SMADs. Expression of TGF-β has been found in cartilage, bones, teeth, muscles, heart, blood vessels, hematopoietic cells, lungs, kidneys, intestines, liver, eyes, ears, skin, and nervous system.Recombinant mouse Transforming Growth factor β2(TGF-β2) is a 112 amino acid polypeptide chain with a molecular mass of 12.7kDa.
Alias:Transforming growth factor beta-2 (TGF-β2), Mouse, RABBIT; transforming growth factor beta-2 (TGF-β2), mouse, RABBIT; TGFB2; BSC-1 cell growth inhibitor; Cetermin; Glioblastoma-derived T-cell suppressor factor; G-TSF; MGC116892; Polyergin; TGF-beta2; TGF-beta-2; transforming growth factor beta-2
Physical properties and indexes:
Purity: >95%
Endotoxin: <1 EU/μg
Titer: >5 x 106units/mg
Expression host: Human Cells
Source: Mouse
Purification Method: purification by chromatography
Character: This product is white loose body
Stability: The freeze-dried powder can be stored at -20℃ for 12 months, the dissolved liquid can be stored at -20℃ for 3 months, and at 4℃ for 1 week, and avoid repeated freeze-thaw
Amino acid sequence:
ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHTKVLSLYNTINPEASASPCCVSQDLEPLTILYYIGNTPKIEQLSNMIVKSCKCS
Usage and Description: Scientific research reagent, widely used in cell biology, pharmacology and other scientific research, is strictly prohibited for human body. TGF-β2 has four basic activities: it is a growth inhibiting factor for most cell types; Enhanced extracellular matrix deposition; It can inhibit the expression of IL-12 and CD40L in antigen-presenting cells and up-regulate the secretion of IL-10. During embryonic development, it is expressed in discrete areas, such as epithelium, myocardium, cartilage and bone of hands and feet, and nervous system, suggesting that it has specific functions.
Instructions for use:
It is recommended that the vial be centrifuged briefly before opening to remove the contents from the bottom. It is recommended to dissolve freeze-dried powder in water for injection, sterilized ultra-pure water or PBS with a concentration of 100μg/ml. Reserve solution should be stored in separate packages for further dilution to working concentration. Avoid repeated freeze-thaw as much as possible.
After resolution, cytokines could be stably stored at 4℃ for 1 week. For short-term storage, please store at -20℃ after repackaging.
【 Attention 】
Our company can only provide partial information for some products, and we do not guarantee the authority of the information provided. The above data are only for reference and research.
This product is only used for scientific research by professionals, and shall not be used for clinical diagnosis or treatment, food or medicine, or stored in ordinary residences.
For your safety and health, please wear a lab coat and disposable gloves.
Our products are only for research purposes (non-clinical research).
Scan Wechat Qrcode