TEL: +86 571 56623320    EMAIL: [email protected]

Recombinant Mesocricetus auratus Major prion protein (PRNP)
Recombinant Mesocricetus auratus Major prion protein (PRNP)
PrPPrP27-30PrP33-35CCD antigen CD230
Total
(Vip priceV)
Regular members: $12.0
  • Save more [Favourable] 30% discount
  • NO.:SIPB651Ha02
    Host:E.coli
    Purity:Greater than 85% as determined by SDS-PAGE.
    Organism Species:Mesocricetus auratus (Golden hamster)
  • Goods click count:41
  • Product Spec:
  • Quantity: - +
  • Limit points for buying:0 Points
  • Manual
  • Add to cart Inquiry Add to favorite
View History [Clear]

Details

Product Name

Recombinant Mesocricetus auratus Major prion protein(PRNP)

Catalog Number

SIPB651Ha02

Expression host

E.coli

Product Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Buffer

Lyophilized from 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0. The volume before lyophilization is 1000μl/vial.

Storage

Store at -20℃, for extended storage, conserve at -20℃ or -80℃ .

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

 

 

 

Relevance

 

Its primary physiological function is unclear. May play a role in neuronal development and synaptic plasticity. May be required for neuronal myelin sheath maintenance. May promote myelin homeostasis through acting as an agonist for ADGRG6 receptor. May play a role in iron uptake and iron homeostasis. Soluble oligomers are toxic to cultured neuroblastoma cells and induce apoptosis (in vitro) (By  similarity). Association with GPC1 (via its heparan sulfate chains) targets PRNP to lipid rafts. Also provides Cu2+ or ZN2+ for the ascorbate-mediated GPC1 deaminase degradation of its heparan sulfate side chains (By similarity).

 

 

 AA sequence

 

KKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGTWGQPHGGGWGQPHGGGW GQPHGGGWGQPHGGGWGQGGGTHNQWNKPSKPKTNMKHMAGAAAAGAVV  GGLGGYMLGSAMSRPMMHFGNDWEDRYYRENMNRYPNQVYYRPVDQYNNQ  NNFVHDCVNITIKQHTVTTTTKGENFTETDIKIMERVVEQMCTTQYQKESQAYY  DGRRS

Partial purchase records(bought amounts latest0)

No one bought this product
Total 0 records, divided into1 pages First Prev Next Last

User Comment(Total0User Comment Num)

  • No comment
Total 0 records, divided into1 pages First Prev Next Last
Username: Anonymous user
E-mail:
Rank:
Content:
Verification code: captcha

Call us

+86 571 56623320

Address

Room 1-315, Kongle Changqing Building, No. 160 Guangye Road,Gongshu District, Hangzhou City, Zhejiang Province, China

Join Us with

Leave a message
* To protect against spam, please pass the CAPTCHA test below.