TEL: +86 571 56623320    EMAIL: SALES@SUNLONGBIOTECH.COM

Recombinant mouse transforming growth factor β1 (TGF-β1), mouse Recombinant
Recombinant mouse transforming growth factor β1 (TGF-β1), mouse Recombinant
Total
(Vip priceV)
Regular members: $320.0
  • NO.:RS002
    Storage:-20℃/4℃
    Appearance:white loose body
    Titer:5 x 106units/mg
    Source:Mouse
  • Goods click count:127
  • Product Spec:
  • Quantity: - +
  • Limit points for buying:0 Points
  • Manual
  • Add to cart Inquiry Add to favorite
View History [Clear]

Details

Transforming growth factor β1(TGF-β1) 
one of the three closely related members of the TGF-β superfamily, has a typical cystine structure and plays an important role in cell formation, cell differentiation, reproduction, development, motility, adhesion, nerve growth, bone morphogenesis, and wound healing. TGF-β1, TGF-β2, and TGF-β3 are pleiotropic cytokines that act as cellular switches to regulate immune function, proliferation, and epithelial interstitial transformation. Expression of TGF-β has been found in cartilage, bones, teeth, muscles, heart, blood vessels, hematopoietic cells, lungs, kidneys, intestines, liver, eyes, ears, skin, and nervous system.

Recombinant mouse TGF-β1 produced by mammalian expression system is a 112 amino acid polypeptide chain with a molecular weight of 12.8kDa.

 

Alias:Transforming growth factor beta-1 (TGF-β1), Mouse, RABBIT, transforming growth factor beta-1 (TGF-β1) TGF-beta-1;  CED;  DPD1;  TGFB;  TGF-b1;  TGFB1;  CEDLAP;  latency-associated peptide;  TGFbeta;  TGF-beta 1 protein

 

Physical properties and indexes:

Purity: >95%

Endotoxin: <1 EU/μg

Titer: >5 x 106units/mg

Expression host: Human Cells

Source: Mouse

Purification Method: purification by chromatography

Character: This product is white loose body

Stability: The freeze-dried powder can be stored at -20℃ for 12 months, the dissolved liquid can be stored at -20℃ for 3 months and at 4℃ for 1 week. For long-term storage, it is recommended to add carrier proteins (e.g. 0.1%BSA) and avoid repeated freeze-thaw

Amino acid sequence:

Ala279-Ser390(Accession #: P04202);

ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

 

Usage and Description:
Scientific research reagent, widely used in cell biology, pharmacology and other scientific research, is strictly prohibited for human body. TGF-β is a multidirectional, multipotent cytokine, which regulates cell proliferation, differentiation and apoptosis through the receptor signaling pathway on the cell surface in an autocrine or paracrine manner. It plays an important role in regulating extracellular matrix synthesis, wound repair and immune function.

TGF-β has three isomers: TGF-β1, TGF-β2, TGF-β3:

TGF-β1: The highest expression in the kidney, distributed in the glomeruli, renal tubules, the strongest activity;

TGF-β2: expressed in paragglomerular apparatus;

TGF-β3: Similar in distribution to TGF-β1, but less abundant.

 

Instructions for use:

It is recommended that the vial be centrifuged briefly before opening to remove the contents from the bottom. It is recommended to dissolve freeze-dried powder in water for injection or sterilized ultra-pure water with a concentration of 100μg/ml. Reserve solution should be stored in separate packages for further dilution to working concentration. Avoid repeated freeze-thaw as much as possible.

After resolution, cytokines could be stably stored at 4℃ for 1 week. For short-term storage, please store at -20℃ after repackaging.

 

Attention

Our company can only provide partial information for some products, and we do not guarantee the authority of the information provided. The above data are only for reference and research.

This product is only used for scientific research by professionals, and shall not be used for clinical diagnosis or treatment, food or medicine, or stored in ordinary residences.

For your safety and health, please wear a lab coat and disposable gloves.

Our products are only for research purposes (non-clinical research).

Bought notes(bought amounts latest0)

No one bought this product
Total 0 records, divided into1 pages First Prev Next Last

User Comment(Total0User Comment Num)

  • No comment
Total 0 records, divided into1 pages First Prev Next Last
Username: Anonymous user
E-mail:
Rank:
Content:
Verification code: captcha

Call us

+86 571 56623320

Address

Room 1-315, Kongle Changqing Building, No. 160 Guangye Road,Gongshu District, Hangzhou City, Zhejiang Province, China

Join Us with

Leave a message
* To protect against spam, please pass the CAPTCHA test below.